PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0003s0147.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family G2-like
Protein Properties Length: 648aa    MW: 69489.2 Da    PI: 5.4331
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0003s0147.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.12e-33289343155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+rlrWtpeLHerFveav++LGG++kAtPk +l++m+vkgLt++hvkSHLQkYRl
  Mapoly0003s0147.1.p 289 KQRLRWTPELHERFVEAVSNLGGADKATPKGVLRVMGVKGLTIYHVKSHLQKYRL 343
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.806286346IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-32286344IPR009057Homeodomain-like
SuperFamilySSF466891.18E-17287343IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-25289344IPR006447Myb domain, plants
PfamPF002493.9E-9291342IPR001005SANT/Myb domain
PfamPF143793.0E-24373419IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MHWVTRTESQ RPAGPPSDVM HRQKVQNWQP SQFNAPPIPP CGNPRFDHTV PGSSAPFIHQ  60
HYGGKQPVLG NPQSPPLLQV SAGYMVPTEA PSRQQVLHPQ PLATSNPPSH SIHSQSISLV  120
PPSSSAPHSS LYSLPPQPQS SVNPPSLHPQ QQYLDAAHSV HQAGHSKPDV DEEFNDQLQR  180
FLDSPDGASS DQMAESPCNE AFGATVEDGW PSWSEYVPDD SGIATCWTNF EPGCESGGDP  240
VVRTVYQSKD YPSLRLPEGG QASDQLQPGA LLQPPSSCGP SGNSAASAKQ RLRWTPELHE  300
RFVEAVSNLG GADKATPKGV LRVMGVKGLT IYHVKSHLQK YRLAKYIPDS VEGKTEKKRN  360
QDIIQQLDQT SGIQLTEALR LQLEVQKRLH EQLEVQRHLQ LRIEAQGKYL QKIIEDQSKF  420
GGVLSYKLVP AGLSDSDPPG TVLLSGSHLS GDIPLPTTLV TLPATEKGQE QTASEPPLKR  480
SRTDDSNLSS ETKVAMPEQV LSVTGSTEPQ LLNDNPSSTV KQAVPQVLDT DQSCNPPLLI  540
SRENDSTASP AQPDTPAQAR QQAGTAERQV LPGSPPQGIV VNPSSSQEAG QVASSTQPSI  600
TSDTGIRPVE LMPDGGSIGK SSLVEAEADL IPPISQVSPP NGTVQAE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.17e-69G2-like family protein